PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G28250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 206aa    MW: 21646.9 Da    PI: 8.1155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G28250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.49.7e-3645100257
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 
                      k+++l+cprC stntkfCyynnys+sqPr+fC+aCrryWt+GG+lr+vPvGg++r+
  ONIVA04G28250.1  45 KQQQLECPRCRSTNTKFCYYNNYSTSQPRHFCRACRRYWTHGGTLRDVPVGGASRR 100
                      7899*************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.5E-3247100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.73649103IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-214993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MAPAVASSPS LVLSAAAATA SNKRPADSDA SPPHQGDRTG QQEKKQQQLE CPRCRSTNTK  60
FCYYNNYSTS QPRHFCRACR RYWTHGGTLR DVPVGGASRR GGGGKRRRVS ADADPSSASP  120
PPPTTSTTDA YADLPAGFPF LSDGAFLPQF GLAGVAPAAF SWASAVPDLY NCGIAPWDDG  180
TAVTGAAWDN FADIAGLDLS WPPPGN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104108KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1075240.0AK107524.1 Oryza sativa Japonica Group cDNA clone:002-129-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448779.19e-70hypothetical protein SORBIDRAFT_06g033010
TrEMBLA0A0D3G1R51e-149A0A0D3G1R5_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9ZSH71e-149A0A0D9ZSH7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H7I91e-149A0A0E0H7I9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PFS61e-149A0A0E0PFS6_ORYRU; Uncharacterized protein
TrEMBLA2XZ001e-149A2XZ00_ORYSI; Putative uncharacterized protein
TrEMBLQ259D31e-149Q259D3_ORYSA; H0402C08.16 protein
TrEMBLQ7FAN81e-149Q7FAN8_ORYSJ;
STRINGLOC_Os04g58190.11e-148(Oryza sativa Japonica Group)
STRINGBGIOSGA014085-PA1e-148(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.12e-28Dof family protein